PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00221.1.g00200.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 857aa    MW: 92689.5 Da    PI: 6.0906
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00221.1.g00200.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox35.12.3e-11241281141
                                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-H CS
                      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLte 41 
                                   +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+ 
  Zpz_sc00221.1.g00200.1.am.mk 241 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEP 281
                                   688999*********************************86 PP

2START21.74e-08427501168
                                   HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCC CS
                         START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveelldd 68 
                                   ela +a++el+++a++++p+W       +++++e+ + f+ + +      + ea+r+s+vv+m+   lve+l+d 
  Zpz_sc00221.1.g00200.1.am.mk 427 ELAVAAMDELIQMAQLDAPLWGVGTagAQLDEEEYARMFPGGIGprqysLRPEASRDSAVVIMTRDSLVEILMDA 501
                                   57899****************887789************88888***99999*********************96 PP

3START131.21.2e-4150160599206
                                   TTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXH CS
                         START  99 qalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlph 178
                                   +++splvp R+++fvRy++ +++g+w++vdvS+ds ++ p    v +++++pSg+li++++ng+skvtwvehv++++r++h
  Zpz_sc00221.1.g00200.1.am.mk 501 AVPSPLVPtRESYFVRYCKNHPDGTWAVVDVSLDSLRPSP----VLKCRRRPSGCLIQEMPNGYSKVTWVEHVEVDERSVH 577
                                   689***********************************98....7************************************ PP

                                   HHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 179 wllrslvksglaegaktwvatlqrqcek 206
                                   +l+++lv+sgla+ga++wv  l+rqce+
  Zpz_sc00221.1.g00200.1.am.mk 578 NLYKPLVNSGLAFGARRWVGILDRQCER 605
                                   **************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-13220283IPR009057Homeodomain-like
SuperFamilySSF466891.67E-9226283IPR009057Homeodomain-like
SMARTSM003895.0E-4239303IPR001356Homeobox domain
CDDcd000862.89E-10241283No hitNo description
PfamPF000465.6E-9241281IPR001356Homeobox domain
SuperFamilySSF559616.53E-25419607No hitNo description
CDDcd088751.72E-87422604No hitNo description
SMARTSM002341.1E-28427605IPR002913START domain
PROSITE profilePS5084826.833447608IPR002913START domain
Gene3DG3DSA:3.30.530.204.9E-4490588IPR023393START-like domain
PfamPF018522.1E-34501605IPR002913START domain
SuperFamilySSF559612.61E-16627828No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 857 aa     Download sequence    Send to blast
MLLRLSAVHY PRTAITPPHL RSPIRRSPSS PELLLRGVLF LPEISACDLL LLAGYELVPS  60
PARLLHAISI PPSSSIPPSL DGAESNRSRD RRYVQIDRST QIDLASPPAS FLCGMVAPAA  120
LDLLPHVLLR GVQATDLPVL DTPSVMTPAR LIGRNGVAYG SSSALSLNQI DLLDNQHLQQ  180
AFQQHLFDPI PAPTLDSGDN MIHGHADTLV DEFESKSCSE NPDGTSGDGG QEDLDQRPNK  240
KKRYHRHTQH QIQEMEAFFK ECPHPDDKQR KELSRELGLE PLQNQHERQE NAQLRAENDK  300
LRSENMRYKE ALSTASCPSC GGPAALGEMS FDEHHLRIEN ARLRDEIDRI SGIAAKHVGK  360
PMVSFPMLPS PLAAAAARSP LDLAGAYGVQ PPSLSADHIF GVGAGAGDLL RSVSTGQLDA  420
DKPMIVELAV AAMDELIQMA QLDAPLWGVG TAGAQLDEEE YARMFPGGIG PRQYSLRPEA  480
SRDSAVVIMT RDSLVEILMD AVPSPLVPTR ESYFVRYCKN HPDGTWAVVD VSLDSLRPSP  540
VLKCRRRPSG CLIQEMPNGY SKVTWVEHVE VDERSVHNLY KPLVNSGLAF GARRWVGILD  600
RQCERLASAM ASNIPNGDLG VITSIEGRKS MLKLAERMVA SFCGGVTASA AHQWTTLSGS  660
GAEDVRIMTR KSVDDPGRPP GIVLNAGTSF WIPVSPKRVF DFLRDETSRS EWDILSNGGT  720
VQEMAHIANG RDHGNCVSLL RVNVMDVVAM NVVLNGGDPD YVALLPSGFS ILPDGPPGTP  780
AEGDNPGGGS LLTVAFQILV DSVPTAKLSL GSVATVNSLI ACTVERIKAA ICGGSKIHQC  840
GVKNAPQTLL AMWCSYC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972697.10.0PREDICTED: homeobox-leucine zipper protein ROC1-like
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLK3YGB70.0K3YGB7_SETIT; Uncharacterized protein
STRINGSi013285m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.30.0homeodomain GLABROUS 2